Recombinant Proteins

Modified or manipulated proteins encoded by recombinant DNA and suitable for a variety of purposes including the modification of gene sequences, mass protein production, and the manufacture of commercial products.

4,756 – 4,770 of 115,748 results

4,756

MilliporeSigma™ TACE, HisTag™, Human, Recombinant Protein, T. ni.

Pricing & Availability

4,757

R&D Systems™ Recombinant Mouse Meprin beta Subunit/MEP1B Protein, CF

Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility. Applications: Enzyme Activity

Pricing & Availability

4,758

R&D Systems™ Recombinant Rat CCL2/JE/MCP-1 Protein

Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility. Applications: Bioactivity

Pricing & Availability
Specifications

Purity or Quality Grade	90%, by SDS-PAGE under reducing conditions and visualized by silver stain.
Conjugate	Unconjugated
Molecular Weight (g/mol)	14 kDa
Gene ID (Entrez)	24770
Quantity	25 μg
Storage Requirements	Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70° C as supplied. 1 month, 2 to 8° C under sterile conditions after reconstitution. 3 months, -20 to -70° C under sterile conditions after reconstitution.
Source	Mouse myeloma cell line,NS0-derived rat CCL2/JE/MCP-1 protein Gln24-Asn148
Recombinant	Recombinant
Name	CCL2/JE/MCP-1

4,759

R&D Systems™ Recombinant Mouse CD155/PVR Fc Chimera Protein

Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility.

Pricing & Availability

4,760

R&D Systems™ Recombinant Porcine Endoglin/CD105 Fc Chimera Protein

Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility.

Pricing & Availability

4,761

MilliporeSigma™ PKA, Catalytic Subunit, Mouse, Recombinant Protein, E. coli

Pricing & Availability

4,762

R&D Systems™ Recombinant Human SIRP alpha His Alexa Fluor™ 647 Protein

His-tag

Pricing & Availability

4,763

Novus Biologicals™ MCEE Protein

Highly purified. Generating reliable and reproducible results.

Pricing & Availability
Specifications

Regulatory Status	RUO
Purification Method	Protein
Purity or Quality Grade	>90%
Conjugate	Unconjugated
Common Name	MCEE
Molecular Weight (g/mol)	17.3kDa
Gene ID (Entrez)	84693
Formulation	20mM Tris-HCl buffer (pH 8.0) containing 0.2M NaCl, 1mM DTT, 0.1mM PMSF, 10% glycerol
Immunogen	MCEE, 37-176 aa. MGSSHHHHHHSSGLVPRGSHMQVTGSVWNLGRLNHVAIAVPDLEKAAAFYKNILGAQVSEAVPLPEHGVSVVFVNLGNTKMELLHPLGRDSPIAGFLQKNKAGGMHHICIEVDNINAAVMDLKKKKIRSLSEEVKIGAHGKPVIFLHPKDCGGVLVELEQA
Storage Requirements	Store at -80°C. Avoid freeze-thaw cycles.
Concentration	1mg/mL
For Use With (Application)	ELISA,SDS-PAGE
Source	Human

4,764

Novus Biologicals™ PPCDC Protein

Highly purified. Generating reliable and reproducible results.

Pricing & Availability
Specifications

Regulatory Status	RUO
Purification Method	Protein
Purity or Quality Grade	>95%
Conjugate	Unconjugated
Common Name	PPCDC
Molecular Weight (g/mol)	24.6kDa
Gene ID (Entrez)	60490
Formulation	Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 10% glycerol, 1mM DTT, 0.1M NaCl.
Immunogen	PPCDC, 1-204 aa. Sequence: MGSSHHHHHHSSGLVPRGSHMEPKASCPAAAPLMERKFHVLVGVTGSVAALKLPLLVSKLLDIPGLEVAVVTTERAKHFYSPQDIPVTLYSDADEWEMWKSRSDPVLHIDLRRWADLLLVAPLDANTLGKVASGICDNLLTCVMRAWDRSKPLLFCPAMNTAMWEHPITAQQVDQLKAFGYVEIPCVAKKLVCGDEGLGAMAEVGTIVDKVKEVLFQHSGFQQS
Storage Requirements	Store at -80°C. Avoid freeze-thaw cycles.
Concentration	1mg/mL
For Use With (Application)	ELISA,SDS-PAGE
Source	Human

4,765

R&D Systems™ Recombinant Canine IL-12/IL-23 p40 Protein

Extensive quality control produces lot-to-lot consistency that instills confidence in results and ensures reproducibility.

Pricing & Availability
Specifications

Purity or Quality Grade	95%, by SDS-PAGE under reducing conditions and visualized by silver stain.
Conjugate	Unconjugated
Molecular Weight (g/mol)	36.3 kDa (monomer)
Gene ID (Entrez)	403976
Quantity	25 μg
Storage Requirements	Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70° C as supplied. 1 month, 2 to 8° C under sterile conditions after reconstitution. 3 months, -20 to -70° C under sterile conditions after reconstitution.
Source	Mouse myeloma cell line,NS0-derived canine IL-12/IL-23 p40 protein Ile23-Ser329,with a C-terminal 10-His tag
Recombinant	Recombinant
Name	IL-12/IL-23 p40

4,766

Novus Biologicals™ Recombinant Human CD37 His Protein

Highly purified. Generating reliable and reproducible results. Applications: SDS-Page

Pricing & Availability
Specifications

Purity or Quality Grade	>90%, by SDS-PAGE under reducing conditions and visualized by Colloidal Coomassie™ Blue stain
Conjugate	Unconjugated
Gene Alias	CD37 antigentetraspanin-26, CD37 molecule, cell differentiation antigen 37, GP52-40, leukocyte antigen CD37, MGC120234, Tetraspanin-26, Tspan-26, TSPAN26leukocyte surface antigen CD37
Common Name	CD37
Molecular Weight (g/mol)	TMW: 17.4kDa
Gene ID (Entrez)	951
Formulation	Phosphate buffer saline(pH 7.4) containing 10% glycerol
Storage Requirements	Store at 4°C short term. Aliquot and store at −20°C long term. Avoid freeze-thaw cycles.
Concentration	1mg/mL
For Use With (Application)	SDS-PAGE
Recombinant	Recombinant

4,767

Gibco™ GM-CSF Recombinant Human Protein

Recombinant Human GM-CSF

Pricing & Availability
Specifications

Shipping Condition	Wet Ice
Bioassay	Proliferation of TF1 cells
Molecular Weight (g/mol)	14 kDa
Endotoxin Level	<0.1 ng/μg
Expression System	E. coli
For Use With (Application)	Cell Culture
Source	Human
Protein Subtype	GM-CSF, G-CSF, & M-CSF
Purification Method	Gel-Purified
Reactivity	Human
Gene Alias	GM-CSF
Protein Form	Full Length, Recombinant, Ligand
Classification	Carrier-Free
Research Category	Clinical Research, Oncology, Stem Cell Research, Differentiation, Signal Transduction, Drug Development
Species	Human
Product Line	Gibco
Recombinant	Recombinant

4,768

R&D Systems™ Recombinant Mouse sTNF RI/TNFRSF1A Protein

Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility. Applications: Bioactivity

Pricing & Availability
Specifications

Purity or Quality Grade	97%, by SDS-PAGE under reducing conditions and visualized by silver stain.
Conjugate	Unconjugated
Molecular Weight (g/mol)	21 kDa
Gene ID (Entrez)	21937
Quantity	50 μg
Storage Requirements	Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70° C as supplied. 1 month, 2 to 8° C under sterile conditions after reconstitution. 3 months, -20 to -70° C under sterile conditions after reconstitution.
Source	E. coli-derived mouse TNF RI/TNFRSF1A protein Ile22-Ala212,with an N-terminal Met
Recombinant	Recombinant
Name	TNF RI/TNFRSF1A

4,769

R&D Systems™ Recombinant Mouse Ephrin-A2 Fc Chimera Protein

Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility.

Pricing & Availability

4,770

R&D Systems™ Recombinant Human Neuroligin 2/NLGN2 Protein

Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility. Applications: Bioactivity

Pricing & Availability

Prev
1
...
316
317
318
319
...
7,717
Next

Welcome to fishersci.com

Recombinant Proteins

Filtered Search Results

Narrow Results

Novus Biologicals™ MCEE Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ PPCDC Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Recombinant Human CD37 His Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ MCEE Protein

Novus Biologicals™ PPCDC Protein

Novus Biologicals™ Recombinant Human CD37 His Protein